PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.204920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 264aa    MW: 29746.6 Da    PI: 7.1131
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.204920.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.72.4e-33150207259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s++prsYYrCts  C+vkk+ver+ +dp++v++tYeg+H+h+
  Cucsa.204920.1 150 EDGYRWRKYGQKAVKNSPHPRSYYRCTSVACNVKKRVERCLQDPSIVVTTYEGQHTHP 207
                     8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-35135209IPR003657WRKY domain
SuperFamilySSF1182901.96E-29141209IPR003657WRKY domain
PROSITE profilePS5081131.387144209IPR003657WRKY domain
SMARTSM007741.2E-39149208IPR003657WRKY domain
PfamPF031064.0E-26150207IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
FYIFPLLMEE VVAADSLRYP FLDASDSKSC LGTFMELLEV DQHFSSQFDV FETSSPSLSS  60
SLISNPENLE IWNQWPTTPN YSSSISSTSS EIVNGELTTE PNLEGGEQKQ DQQPTVKADK  120
QLKTKKRSPK KKGAEPRFAF MTKSEVDHLE DGYRWRKYGQ KAVKNSPHPR SYYRCTSVAC  180
NVKKRVERCL QDPSIVVTTY EGQHTHPSPI MARFTMLAKI FDPPQVSIIT LGIPRNSISD  240
YMGSERIGFD TMNMEGGLIR HGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-27133209177Probable WRKY transcription factor 4
2lex_A5e-27133209177Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840370.0GU984037.1 Cucumis sativus WRKY protein (WRKY52) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001267684.11e-130probable WRKY transcription factor 68-like
TrEMBLE7CEY61e-130E7CEY6_CUCSA; Uncharacterized protein
STRINGGLYMA19G40560.12e-56(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.16e-46WRKY DNA-binding protein 23